Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r220 (NM_134237) Mouse Tagged ORF Clone Lentiviral Particle
MR223555L4V 200 µL

Vmn1r220 (NM_134237) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Aβ-IN-7
HY-149582 1 Each

Aβ-IN-7

Sign In for Pricing
View Details
Recombinant Human Cd5L (C-6His)
FY-PN53306 10 µg

Recombinant Human Cd5L (C-6His)

Sign In for Pricing
View Details
Lentiviral mouse Cd38 shRNA (UAS) - Lentiviral mouse Cd38 shRNA (UAS, GFP) (100)
GTR15224805 1 Vial

Lentiviral mouse Cd38 shRNA (UAS) - Lentiviral mouse Cd38 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit Anti-Human DHFR pAb
PA9747-01 50 μL

Rabbit Anti-Human DHFR pAb

Sign In for Pricing
View Details
Rabbit Anti-Human DHFR pAb
PA9747-02 100 μL

Rabbit Anti-Human DHFR pAb

Sign In for Pricing
View Details