Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRM1
CR259-0.1ml 0.1 mL

RRM1

Sign In for Pricing
View Details
Lentiviral mouse Mto1 shRNA (UAS) - Lentiviral mouse Mto1 shRNA (UAS, RFP) (100)
GTR15290580 1 Vial

Lentiviral mouse Mto1 shRNA (UAS) - Lentiviral mouse Mto1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Natt-Herricks Solution, 16oz, ADI
5593 16 Oz

Natt-Herricks Solution, 16oz, ADI

Sign In for Pricing
View Details
HSPEP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1002502 1.0 µg DNA

HSPEP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL)
MBS2167628-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL)
MBS2167628-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL)

Sign In for Pricing
View Details