TRAIL R2/TNFRSF10B, Human (HEK293)
TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.
Product Specifications
Product Name Alternative
TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html
Purity
96.06
Smiles
ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Molecular Formula
8795 (Gene_ID) O14763 (A54-E182) (Accession)
Molecular Weight
Approximately 16.22 kDa
References & Citations
[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
128940-PE 100 µL
KRT19 (Keratin, Type I Cytoskeletal 19, Cytokeratin-19, CK-19, Keratin-19, K19, MGC15366) (PE)
Sign In for Pricing
View Details 
MBS5789153 Inquire
Amylin, amide, Human TFA (122384-88-7 free base)
Sign In for Pricing
View Details 
MBS1303400-01 0.02 mg (E-Coli)
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 228L (IIV6-228L)
Sign In for Pricing
View Details MBS1303400-02 0.02 mg (Yeast)
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 228L (IIV6-228L)
Sign In for Pricing
View Details MBS1303400-03 0.1 mg (E-Coli)
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 228L (IIV6-228L)
Sign In for Pricing
View Details