Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-AKR1E2 (human) -shRNA2-CopGFP-Puro
BZ63296 1 Vial

PLV3-U6-AKR1E2 (human) -shRNA2-CopGFP-Puro

Sign In for Pricing
View Details
Aup1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4678407 1.0 µg DNA

Aup1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ATP13A1 Antibody
MBS9630698-01 0.1 mL

ATP13A1 Antibody

Sign In for Pricing
View Details
ATP13A1 Antibody
MBS9630698-02 0.2 mL

ATP13A1 Antibody

Sign In for Pricing
View Details
ATP13A1 Antibody
MBS9630698-03 5x 0.2 mL

ATP13A1 Antibody

Sign In for Pricing
View Details
uLK3 (NM_015518) Human Untagged Clone
SC120916 10 µg

uLK3 (NM_015518) Human Untagged Clone

Sign In for Pricing
View Details