TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

K0124304 1.0 µg DNA

ARMC8 sgRNA CRISPR Lentivector (Human) (Target 3)

View Details

NBP2-47700JF549 0.1 mL

Mouse Monoclonal beta 2-Microglobulin Antibody (246-E9.E7 (same as HLA.ABC.m2)) [Janelia Fluor 549]

View Details

VAng-Cr0541-500gEcoli 500 µg (E. coli)

Recombinant Pseudomonas Aeruginosa lpxK Protein (aa 1-332) (strain LESB58)

View Details

MBS9012112 Inquire

Rabbit anti-Caenorhabditis elegans mdt-20 Polyclonal Antibody

View Details

AC-40-08 1 mL

Anti-Mouse IgG F (ab') 2 Fragment - 40nm Gold Conjugate

View Details

MBS1365547-01 0.02 mg (E-Coli)

Recombinant Chicken REST corepressor 3 (RCOR3)

View Details