Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLGA2K-TK-PEG2K-FA
S01YF-0823-KX506 Each

PLGA2K-TK-PEG2K-FA

Sign In for Pricing
View Details
ACE2 3'UTR Luciferase Stable Cell Line
TU000157 1.0 mL

ACE2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Serpin B12 (SERPINB12) ELISA Kit
AE20028MO-01 48 Tests

Mouse Serpin B12 (SERPINB12) ELISA Kit

Sign In for Pricing
View Details
Mouse Serpin B12 (SERPINB12) ELISA Kit
AE20028MO-02 96 Tests

Mouse Serpin B12 (SERPINB12) ELISA Kit

Sign In for Pricing
View Details
Rat Prodh Pre-designed siRNA Set A
SI211116A 1 Each

Rat Prodh Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-CDH6 antibody(DMC6765), IgG1 Chimeric mAb
TA389588 100 µg

Anti-CDH6 antibody(DMC6765), IgG1 Chimeric mAb

Sign In for Pricing
View Details