TRAIL R2/TNFRSF10B, Human (HEK293)
TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.
Product Specifications
Product Name Alternative
TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html
Purity
96.06
Smiles
ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Molecular Formula
8795 (Gene_ID) O14763 (A54-E182) (Accession)
Molecular Weight
Approximately 16.22 kDa
References & Citations
[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2281404 1.0 µg DNA
SPSB3 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
32-8574-10 10 µg
Recombinant Human Biliverdin Reductase A/BVR A (C-6His)
Sign In for Pricing
View Details ELK7596-01 48 Tests
Mouse GUCA2A (Guanylate Cyclase Activator 2A) ELISA Kit
Sign In for Pricing
View Details 
ELK7596-02 96 Tests
Mouse GUCA2A (Guanylate Cyclase Activator 2A) ELISA Kit
Sign In for Pricing
View Details ELK7596-03 5x 96 Tests
Mouse GUCA2A (Guanylate Cyclase Activator 2A) ELISA Kit
Sign In for Pricing
View Details