Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPSL (NM_001042625) Human Tagged Lenti ORF Clone
RC205410L4 10 µg

CAPSL (NM_001042625) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rac 2 CRISPR Activation Plasmid (m2)
sc-422574-ACT-2 20 µg

Rac 2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
C4-2 Cell Complete Medium
CM-0046 4x 125 mL

C4-2 Cell Complete Medium

Sign In for Pricing
View Details
Ilk (NM_010562) Mouse Recombinant Protein
PM46293M5 20 µg

Ilk (NM_010562) Mouse Recombinant Protein

Sign In for Pricing
View Details
RUFY4 Lentiviral Activation Particles (h)
sc-405000-LAC 200 µL

RUFY4 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
PLV3-CMV-EGFP-TGOLN2-3xFLAG-Puro Plasmid
PVT83722 2 µg

PLV3-CMV-EGFP-TGOLN2-3xFLAG-Puro Plasmid

Sign In for Pricing
View Details