Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNS4 Antibody
E38QA6244 100 µL

TNS4 Antibody

Sign In for Pricing
View Details
IARS2 (Isoleucyl-tRNA Synthetase 2 Mitochondrial, IleRS, FLJ10326, Isoleucine-tRNA Ligase) (PE)
MBS6481359-01 0.2 mL

IARS2 (Isoleucyl-tRNA Synthetase 2 Mitochondrial, IleRS, FLJ10326, Isoleucine-tRNA Ligase) (PE)

Sign In for Pricing
View Details
IARS2 (Isoleucyl-tRNA Synthetase 2 Mitochondrial, IleRS, FLJ10326, Isoleucine-tRNA Ligase) (PE)
MBS6481359-02 5x 0.2 mL

IARS2 (Isoleucyl-tRNA Synthetase 2 Mitochondrial, IleRS, FLJ10326, Isoleucine-tRNA Ligase) (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal RGS14 Antibody
NBP3-38632-20ul 20 µL

Rabbit Polyclonal RGS14 Antibody

Sign In for Pricing
View Details
KDM4B Knockout HGC-27 Polyclonal Cells
ARG30102 1 Million

KDM4B Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
Ubxn1 (NM_001034829) Rat Tagged Lenti ORF Clone
RR212547L4 10 µg

Ubxn1 (NM_001034829) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details