Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFT2B Recombinant Protein Antigen
NBP1-88013PEP 0.1 mL

SFT2B Recombinant Protein Antigen

Sign In for Pricing
View Details
Gm7361 (NM_001281527) Mouse Tagged ORF Clone
MR228903 10 µg

Gm7361 (NM_001281527) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MT1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1356806 1.0 µg DNA

MT1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human KIF5A Protein, N-His
E55P2279 50 µg

Recombinant Human KIF5A Protein, N-His

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: carotid
CS501351 5x 5 µm

Frozen Tissue Sections, Artery: carotid

Sign In for Pricing
View Details
Pax4 (NM_031799) Rat Tagged Lenti ORF Clone
RR208036L4 10 µg

Pax4 (NM_031799) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details