TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS1584206-01 50 Tests

Anti-Human CD146/MUC18/MCAM Antibody (SAA0060), PE

View Details

MBS1584206-02 100 Tests

Anti-Human CD146/MUC18/MCAM Antibody (SAA0060), PE

View Details

MBS1584206-03 5x 100 Tests

Anti-Human CD146/MUC18/MCAM Antibody (SAA0060), PE

View Details

AM31228AF-N 200 µg

CD19 Mouse Monoclonal Antibody [Clone ID: B-C3]

View Details

NBP2-90237MFV610 0.1 mL

Rabbit Monoclonal TMEM25 Antibody (009) [mFluor Violet 610 SE]

View Details

TA811402 100 µL

VRK2 Mouse Monoclonal Antibody [Clone ID: OTI8H5]

View Details