TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV003928 500 ng

BCL2L13 Protein Vector (Human) (pPM-C-His)

View Details

TA502324AM 100 µL

SERPINB4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H8]

View Details

BDE18001ZT10 10 mL

BDE 180 10ug/ml in Iso-octane

View Details

MBS2578528-01 0.025 mg

GOT1/AST (Aspartate Aminotransferase) Polyclonal Antibody (Capture/Detector)

View Details

MBS2578528-02 0.1 mg

GOT1/AST (Aspartate Aminotransferase) Polyclonal Antibody (Capture/Detector)

View Details

MBS2578528-03 1 mg

GOT1/AST (Aspartate Aminotransferase) Polyclonal Antibody (Capture/Detector)

View Details