Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

na Human shRNA Plasmid Kit (Locus ID 149767)
TL319361 1 Kit

na Human shRNA Plasmid Kit (Locus ID 149767)

Sign In for Pricing
View Details
Elk-1(Phospho Ser389) Polyclonal Antibody
JOT-AP08804-01 50ul

Elk-1(Phospho Ser389) Polyclonal Antibody

Sign In for Pricing
View Details
Elk-1(Phospho Ser389) Polyclonal Antibody
JOT-AP08804-02 100ul

Elk-1(Phospho Ser389) Polyclonal Antibody

Sign In for Pricing
View Details
Microscope Slide Boxes,25-Place, Green
LC7008-010 10 / Pack

Microscope Slide Boxes,25-Place, Green

Sign In for Pricing
View Details
APOC1 Antibody
A46696-50UL 50 μL

APOC1 Antibody

Sign In for Pricing
View Details
ID1 Knockout HGC-27 Polyclonal Cells
ARG29990 1 Million

ID1 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details