Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP4 (1-132aa) Monoclonal Antibody
E53M01245 100 µL

FABP4 (1-132aa) Monoclonal Antibody

Sign In for Pricing
View Details
TNFAIP2 Polyclonal Antibody, Cy3 Conjugated
bs-7049R-Cy3 100 µL

TNFAIP2 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
RALBP1 Rabbit mAb
E45R11814N-100 100 µL

RALBP1 Rabbit mAb

Sign In for Pricing
View Details
BTBD2 (BTB/POZ Domain-containing Protein 2, BTB (POZ) Domain Containing 2)
476415 100 µL

BTBD2 (BTB/POZ Domain-containing Protein 2, BTB (POZ) Domain Containing 2)

Sign In for Pricing
View Details
Human CLIC2 knockdown cell line
ABC-KD3220 1 Vial

Human CLIC2 knockdown cell line

Sign In for Pricing
View Details
Human NKp46/NCR1 Alexa Fluor 488 Antibody (Clone 195314)
FAB1850G-100UG 100 µg

Human NKp46/NCR1 Alexa Fluor 488 Antibody (Clone 195314)

Sign In for Pricing
View Details