TRAIL R2/TNFRSF10B, Human (HEK293)
TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.
Product Specifications
Product Name Alternative
TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html
Purity
96.06
Smiles
ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Molecular Formula
8795 (Gene_ID) O14763 (A54-E182) (Accession)
Molecular Weight
Approximately 16.22 kDa
References & Citations
[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
43941154 3x 1.0 µg DNA
SLC22A15 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details 
JH92254 1 Each
(R) -tert-Butyl 2- (methylcarbamoyl) piperazine-1-carboxylate hydrochloride
Sign In for Pricing
View Details MBS9916217 Inquire
Duck Ubiquinone Biosynthesis Monooxygenase COQ6 (COQ6) ELISA Kit
Sign In for Pricing
View Details