Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOD, Human (HEK293, C-His)

APOD Proteinas is an anti-inflammatory antagonist in the IL-1 family, targeting IL1B and IL1A to prevent immune dysregulation and systemic inflammation. Its ability to modulate inflammatory responses has important implications for potential therapeutic intervention in inflammatory diseases. APOD Protein, Human (HEK293, C-His) is the recombinant human-derived APOD protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

APOD Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apod-protein-human-hek293-c-his.html

Purity

98.0

Smiles

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

Molecular Formula

347 (Gene_ID) P05090 (Q21-S189) (Accession)

Molecular Weight

25-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctsq Rat siRNA Oligo Duplex (Locus ID 246147)
SR503872 1 Kit

Ctsq Rat siRNA Oligo Duplex (Locus ID 246147)

Sign In for Pricing
View Details
BBX antibody - middle region
MBS3204607-01 0.1 mL

BBX antibody - middle region

Sign In for Pricing
View Details
BBX antibody - middle region
MBS3204607-02 5x 0.1 mL

BBX antibody - middle region

Sign In for Pricing
View Details
Unoprostone-d15 Isopropyl Ester
MBS6111708-01 1 mg

Unoprostone-d15 Isopropyl Ester

Sign In for Pricing
View Details
Unoprostone-d15 Isopropyl Ester
MBS6111708-02 5x 1 mg

Unoprostone-d15 Isopropyl Ester

Sign In for Pricing
View Details
RNU6-29 Recombinant Protein (Human)
RP089076 100 µg

RNU6-29 Recombinant Protein (Human)

Sign In for Pricing
View Details