Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2) (Active)

Product Specifications

Product Name Alternative

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Abbreviation

Recombinant Human FGF2 protein (Active)

Gene Name

FGF2

UniProt

P09038-4

Expression Region

143-288aa

Organism

Homo sapiens (Human)

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-2.0 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20mM Tris-Hcl, 250mM NaCl, pH 7.5.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform 1

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Oxo-zoniporide hydrochloride
T89456-01 10 mg

2-Oxo-zoniporide hydrochloride

Sign In for Pricing
View Details
2-Oxo-zoniporide hydrochloride
T89456-02 50 mg

2-Oxo-zoniporide hydrochloride

Sign In for Pricing
View Details
GNAL Peptide (AAP54634)
AAP54634-100UG 100 µg

GNAL Peptide (AAP54634)

Sign In for Pricing
View Details
CWF19L2 Protein Vector (Mouse) (pPB-N-His)
PV169119 500 ng

CWF19L2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
MLANA Antibody (HRP)
abx307031-01 20 µg

MLANA Antibody (HRP)

Sign In for Pricing
View Details
MLANA Antibody (HRP)
abx307031-02 50 µg

MLANA Antibody (HRP)

Sign In for Pricing
View Details