Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Mouse (HEK293, His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa) . In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-mouse-hek293-his.html

Purity

98.0

Smiles

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Molecular Formula

21788 (Gene_ID) NP_035706.1 (L29-K289) (Accession)

Molecular Weight

Approximately 45 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gpc4 Pre-designed siRNA Set A
SI105710A 1 Each

Mouse Gpc4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GSTCD Protein Lysate
OCOA08193-20UG 20 µg

GSTCD Protein Lysate

Sign In for Pricing
View Details
pCMV-SPORT6-Phf5a Plasmid
PVT56194 2 µg

pCMV-SPORT6-Phf5a Plasmid

Sign In for Pricing
View Details
MYSM1 Antibody - N-terminal region
ARP67189_P050-25UL 25 µL

MYSM1 Antibody - N-terminal region

Sign In for Pricing
View Details
HOXA1 Rabbit Polyclonal Antibody
orb329793 100 µL

HOXA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zebrafish IL4 (Interleukin 4) ELISA Kit
EK247876 96 Well

Zebrafish IL4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details