Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Mouse (HEK293, His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa) . In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-mouse-hek293-his.html

Purity

98.0

Smiles

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Molecular Formula

21788 (Gene_ID) NP_035706.1 (L29-K289) (Accession)

Molecular Weight

Approximately 45 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R3B Antibody, Biotin conjugated
CSB-PA769802LD01HU-01 50 µg

PPP1R3B Antibody, Biotin conjugated

Sign In for Pricing
View Details
PPP1R3B Antibody, Biotin conjugated
CSB-PA769802LD01HU-02 100 µg

PPP1R3B Antibody, Biotin conjugated

Sign In for Pricing
View Details
PKA gamma Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-3964R-BF594 100 µL

PKA gamma Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
PIP4K2A Protein Vector (Rat) (pPM-C-HA)
36708026 500 ng

PIP4K2A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
DHI1L Rabbit pAb, PerCP-Cy7 conjugated
orb2867214 100 µL

DHI1L Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Di-4-ANEPPS
sc-214872A 50 mg

Di-4-ANEPPS

Sign In for Pricing
View Details