Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Thiosulfate-binding protein (cysP)

Product Specifications

Product Name Alternative

CysP; b2425; JW2418; Thiosulfate-binding protein

Abbreviation

Recombinant E.coli cysP protein

Gene Name

CysP

UniProt

P16700

Expression Region

26-338aa

Organism

Escherichia coli (strain K12)

Target Sequence

TELLNSSYDVSRELFAALNPPFEQQWAKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWNDLVRSDVKLIFPNPKTSGNARYTYLAAWGAADKADGGDKGKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIITDYYYRVNNPEVMDKLKDKFPQTELFRVEDKFGSWPEVMKTHFTSGGELDKLLAAGRN

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Part of the ABC transporter complex CysAWTP involved in sulfate/thiosulfate import. This protein specifically binds thiosulfate and is involved in its transmembrane transport.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.0 kDa

References & Citations

"Interaction network containing conserved and essential protein complexes in Escherichia coli." Butland G., Peregrin-Alvarez J.M., Li J., Yang W., Yang X., Canadien V., Starostine A., Richards D., Beattie B., Krogan N., Davey M., Parkinson J., Greenblatt J., Emili A. Nature 433:531-537 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TADA2L Adenovirus (Human)
46064052 1.0 mL

TADA2L Adenovirus (Human)

Sign In for Pricing
View Details
H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)
abx409814-01 50 Tests

H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)

Sign In for Pricing
View Details
H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)
abx409814-02 100 Tests

H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)

Sign In for Pricing
View Details
H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)
abx409814-03 25 µg

H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)

Sign In for Pricing
View Details
H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)
abx409814-04 200 Tests

H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)

Sign In for Pricing
View Details
H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)
abx409814-05 100 µg

H-2 Class II Histocompatibility Antigen (H2-AB1) Antibody (AF700)

Sign In for Pricing
View Details