Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphopain B, S. aureus (GST)

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Staphopain B Protein, S. aureus (GST), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/staphopain-b-protein-s-aureus-gst.html

Purity

90.00

Smiles

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Molecular Formula

/ (Gene_ID) Q99V46 (D220-Y393) (Accession)

Molecular Weight

Approximately 46.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7241346-01 48 Well

Sheep Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Sheep Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7241346-02 96 Well

Sheep Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Sheep Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7241346-03 5x 96 Well

Sheep Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Sheep Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7241346-04 10x 96 Well

Sheep Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
PHYHIPL Protein Vector (Mouse) (pPM-C-HA)
PV215900 500 ng

PHYHIPL Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal MAGE 1 Antibody (MZ2E/838) [mFluor Violet 500 SE]
NBP3-11463MFV500 0.1 mL

Mouse Monoclonal MAGE 1 Antibody (MZ2E/838) [mFluor Violet 500 SE]

Sign In for Pricing
View Details