Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphopain B, S. aureus (GST)

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Staphopain B Protein, S. aureus (GST), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/staphopain-b-protein-s-aureus-gst.html

Purity

90.00

Smiles

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Molecular Formula

/ (Gene_ID) Q99V46 (D220-Y393) (Accession)

Molecular Weight

Approximately 46.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ralgps2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6498806 1.0 µg DNA

Ralgps2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
HABP2, CT (HABP2, HGFAL, PHBP, Hyaluronan-binding protein 2, Factor VII-activating protease, Factor seven-activating protease, Hepatocyte growth factor activator-like protein, Plasma hyaluronan-binding protein, Hyaluronan-binding protein 2 50kD heavy chai
MBS6305325-01 0.1 mL

HABP2, CT (HABP2, HGFAL, PHBP, Hyaluronan-binding protein 2, Factor VII-activating protease, Factor seven-activating protease, Hepatocyte growth factor activator-like protein, Plasma hyaluronan-binding protein, Hyaluronan-binding protein 2 50kD heavy chai

Sign In for Pricing
View Details
HABP2, CT (HABP2, HGFAL, PHBP, Hyaluronan-binding protein 2, Factor VII-activating protease, Factor seven-activating protease, Hepatocyte growth factor activator-like protein, Plasma hyaluronan-binding protein, Hyaluronan-binding protein 2 50kD heavy chai
MBS6305325-02 5x 0.1 mL

HABP2, CT (HABP2, HGFAL, PHBP, Hyaluronan-binding protein 2, Factor VII-activating protease, Factor seven-activating protease, Hepatocyte growth factor activator-like protein, Plasma hyaluronan-binding protein, Hyaluronan-binding protein 2 50kD heavy chai

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC21 Antibody [DyLight 755]
NBP1-78219IR 0.1 mL

Rabbit Polyclonal CCDC21 Antibody [DyLight 755]

Sign In for Pricing
View Details
Recombinant Human High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor (FCAMR), partial
MBS1445618-01 0.5 mg (E-Coli)

Recombinant Human High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor (FCAMR), partial

Sign In for Pricing
View Details
Recombinant Human High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor (FCAMR), partial
MBS1445618-02 0.05 mg (Baculovirus)

Recombinant Human High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor (FCAMR), partial

Sign In for Pricing
View Details