Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphopain B, S. aureus (GST)

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Staphopain B Protein, S. aureus (GST), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/staphopain-b-protein-s-aureus-gst.html

Purity

90.00

Smiles

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Molecular Formula

/ (Gene_ID) Q99V46 (D220-Y393) (Accession)

Molecular Weight

Approximately 46.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial
MBS1217881-01 0.5 mg (E-Coli)

Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial

Ask
View Details
Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial
MBS1217881-02 0.05 mg (Baculovirus)

Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial

Ask
View Details
Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial
MBS1217881-03 0.05 mg (Mammalian-Cell)

Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial

Ask
View Details
Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial
MBS1217881-04 0.5 mg (Yeast)

Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial

Ask
View Details
Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial
MBS1217881-05 1 mg (E-Coli)

Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial

Ask
View Details
Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial
MBS1217881-06 0.1 mg (Baculovirus)

Recombinant Human adenovirus C serotype 2 Penton protein (PIII), partial

Ask
View Details