Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphopain B, S. aureus (GST)

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Staphopain B Protein, S. aureus (GST), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/staphopain-b-protein-s-aureus-gst.html

Purity

90.00

Smiles

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Molecular Formula

/ (Gene_ID) Q99V46 (D220-Y393) (Accession)

Molecular Weight

Approximately 46.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emx2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4365908 1.0 µg DNA

Emx2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Phospho-ERBB3 (Y1289) Antibody
A21316-100UG 100 µg

Phospho-ERBB3 (Y1289) Antibody

Sign In for Pricing
View Details
anti-HP1 alpha
YF-PA25897 50 ul

anti-HP1 alpha

Sign In for Pricing
View Details
Anticancer agent 34
MBS5805434 Inquire

Anticancer agent 34

Sign In for Pricing
View Details
C4orf44-set siRNA/shRNA/RNAi Lentivector (Human)
53801091 4x 500 ng

C4orf44-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Ceruloplasmin Antibody
E38QA4148 100 µL

Ceruloplasmin Antibody

Sign In for Pricing
View Details