CD177, Human (HEK293, His)
CD177 Protein, Human (HEK293, His) is a recombinant human CD177 expressed in HEK 293 cells with a His tag at the N-terminus. CD177 Protein is an important biomarker of myeloproliferative diseases[1][2].
Product Specifications
Product Name Alternative
CD177 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd177-protein-human-hek293-his.html
Purity
98.0
Smiles
LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGHHHHHH
Molecular Formula
57126 (Gene_ID) AAH29167.1 (L22-G407) (Accession)
Molecular Weight
51-55 kDa
References & Citations
[1]Stroncek DF. Neutrophil-specific antigen HNA-2a, NB1 glycoprotein, and CD177. Curr Opin Hematol. 2007 Nov;14 (6) :688-93.|[2]Kissel K, et, al. Molecular basis of the neutrophil glycoprotein NB1 (CD177) involved in the pathogenesis of immune neutropenias and transfusion reactions. Eur J Immunol. 2001 May;31 (5) :1301-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740287-100 1x 100 µL
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680040-500 1x 500 µL
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740631-500 1x 500 µL
Human Lambda Light Chain (LcN-2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details