Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynephage omega Diphtheria toxin, partial

Product Specifications

Product Name Alternative

NAD (+) --diphthamide ADP-ribosyltransferase

Abbreviation

Recombinant Corynephage omega Diphtheria toxin protein, partial

UniProt

P00587

Expression Region

26-218aa

Organism

Corynephage omega

Target Sequence

GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Iphtheria toxin, produced by a phage infecting Corynebacterium diphtheriae, is a proenzyme that, after activation, catalyzes the covalent attachment of the ADP ribose moiety of NAD to elongation factor 2. Fragment A is responsible for enzymatic ADP-ribosylation of elongation factor 2, while fragment B is responsible for binding of toxin to cell receptors and entry of fragment A.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.6 kDa

References & Citations

"The complete nucleotide sequence of the gene coding for diphtheria toxin in the corynephage omega (tox+) genome." Ratti G., Rappuoli R., Giannini G. Nucleic Acids Res. 11:6589-6595 (1983)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xanomeline N-Oxide
RM-X011306-01 10 mg

Xanomeline N-Oxide

Sign In for Pricing
View Details
Xanomeline N-Oxide
RM-X011306-02 25 mg

Xanomeline N-Oxide

Sign In for Pricing
View Details
Xanomeline N-Oxide
RM-X011306-03 50 mg

Xanomeline N-Oxide

Sign In for Pricing
View Details
Xanomeline N-Oxide
RM-X011306-04 100 mg

Xanomeline N-Oxide

Sign In for Pricing
View Details
Guinea Pig F box/LRR repeat protein 8 (FBXL8) ELISA kit
GTR10434304 96 Well

Guinea Pig F box/LRR repeat protein 8 (FBXL8) ELISA kit

Sign In for Pricing
View Details
4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) -1H-pyrazole-1-ethanol
161065 250 mg

4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) -1H-pyrazole-1-ethanol

Sign In for Pricing
View Details