Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL7/Angiopoietin-related 7, Human (HEK293, His)

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His) regulates angiogenesis, and promotes the expansion and repopulation of human hematopoietic stem cells and progenitor cells through the Wnt signaling pathway. Angiopoietin-related Protein 7 is a pro-inflammatory effector that induces inflammatory responses in macrophages through the P38 MAPK signaling pathway.

Product Specifications

Product Name Alternative

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-related-protein-7-protein-human-hek293-his.html

Purity

98.0

Smiles

QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKPHHHHHHHHHH

Molecular Formula

10218 (Gene_ID) O43827 (Q27-P346) (Accession)

Molecular Weight

34 kDa & (45-55) kDa

References & Citations

[1]Qian T, et al. Angiopoietin-Like Protein 7 Promotes an Inflammatory Phenotype in RAW264.7 Macrophages Through the P38 MAPK Signaling Pathway. Inflammation. 2016 Jun;39 (3) :974-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF647 conjugate, 0.1mg/mL
BNC470324-100 1x 100 µL

CD53 (161-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF594 conjugate, 0.1mg/mL
BNC940746-100 1x 100 µL

CD5 (CD5/54/F6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5), CF647 conjugate, 0.1mg/mL
BNC470015-500 1x 500 µL

CD56 / NCAM (123C3.D5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL
BNC472052-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details