Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C3A/NT5C3, Human

NT5C3A/NT5C3 Protein, a nucleotidase, preferentially hydrolyzes cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m (7) GMP), emphasizing a potential role in cellular processes, with a preference for CMP. NT5C3A/NT5C3 Protein, Human is the recombinant human-derived NT5C3A/NT5C3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NT5C3A/NT5C3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nt5c3a-nt5c3-protein-human.html

Purity

99.00

Smiles

MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Molecular Formula

51251 (Gene_ID) Q9H0P0-1 (M12-L297) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-(+)-Carvone Tosylhydrazone
TRC-M758545-50MG 50 mg

D-(+)-Carvone Tosylhydrazone

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD54 Antibody[YN1/1.7.4]
E-AB-F1018L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD54 Antibody[YN1/1.7.4]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD54 Antibody[YN1/1.7.4]
E-AB-F1018L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD54 Antibody[YN1/1.7.4]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD54 Antibody[YN1/1.7.4]
E-AB-F1018L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD54 Antibody[YN1/1.7.4]

Sign In for Pricing
View Details
Mono-7-carboxyheptyl Phthalate
TRC-M525580-25MG 25 mg

Mono-7-carboxyheptyl Phthalate

Sign In for Pricing
View Details
Bcl-2 (8C8), CF740 conjugate, 0.1mg/mL
BNC740005-100 1x 100 µL

Bcl-2 (8C8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details