Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C3A/NT5C3, Human

NT5C3A/NT5C3 Protein, a nucleotidase, preferentially hydrolyzes cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m (7) GMP), emphasizing a potential role in cellular processes, with a preference for CMP. NT5C3A/NT5C3 Protein, Human is the recombinant human-derived NT5C3A/NT5C3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NT5C3A/NT5C3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nt5c3a-nt5c3-protein-human.html

Purity

99.00

Smiles

MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Molecular Formula

51251 (Gene_ID) Q9H0P0-1 (M12-L297) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycerol Colorimetric Assay Kit
E-BC-K340-M-01 48 T (32 samples)

Glycerol Colorimetric Assay Kit

Sign In for Pricing
View Details
Glycerol Colorimetric Assay Kit
E-BC-K340-M-02 96 T (80 samples)

Glycerol Colorimetric Assay Kit

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF568 conjugate, 0.1mg/mL
BNC682993-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF568 conjugate, 0.1mg/mL
BNC681789-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adracalin (AAAS) Human Gene Knockout Kit (CRISPR)
KN400154 1 Kit

Adracalin (AAAS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myc-Tag Monoclonal Antibody
E-AB-48024-01 25 µL

Myc-Tag Monoclonal Antibody

Sign In for Pricing
View Details