Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C3A/NT5C3, Human

NT5C3A/NT5C3 Protein, a nucleotidase, preferentially hydrolyzes cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m (7) GMP), emphasizing a potential role in cellular processes, with a preference for CMP. NT5C3A/NT5C3 Protein, Human is the recombinant human-derived NT5C3A/NT5C3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NT5C3A/NT5C3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nt5c3a-nt5c3-protein-human.html

Purity

99.00

Smiles

MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Molecular Formula

51251 (Gene_ID) Q9H0P0-1 (M12-L297) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OptiWell™ Deep Well Plates
D3096-07 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
KCTD7 Rabbit Polyclonal Antibody
TA372850 100 µL

KCTD7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AIRE (NM_000658) Human Over-expression Lysate
LC424585 20 µg

AIRE (NM_000658) Human Over-expression Lysate

Sign In for Pricing
View Details
SEPTIN5 (NM_002688) Human Over-expression Lysate
LY419167 100 µg

SEPTIN5 (NM_002688) Human Over-expression Lysate

Sign In for Pricing
View Details
(5Alpha)-Estrane-3,17-dione-d6
TRC-E668422-5MG 5 mg

(5Alpha)-Estrane-3,17-dione-d6

Sign In for Pricing
View Details
Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody
E-AB-V1226-01 20 µL

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody

Sign In for Pricing
View Details