Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C3A/NT5C3, Human

NT5C3A/NT5C3 Protein, a nucleotidase, preferentially hydrolyzes cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m (7) GMP), emphasizing a potential role in cellular processes, with a preference for CMP. NT5C3A/NT5C3 Protein, Human is the recombinant human-derived NT5C3A/NT5C3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NT5C3A/NT5C3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nt5c3a-nt5c3-protein-human.html

Purity

99.00

Smiles

MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Molecular Formula

51251 (Gene_ID) Q9H0P0-1 (M12-L297) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS26 (NM_030811) Human Over-expression Lysate
LC403084 20 µg

MRPS26 (NM_030811) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIM21 Antibody
KC-7213-01 50 μL

TRIM21 Antibody

Sign In for Pricing
View Details
TRIM21 Antibody
KC-7213-02 100 µL

TRIM21 Antibody

Sign In for Pricing
View Details
TRIM21 Antibody
KC-7213-03 1 mL

TRIM21 Antibody

Sign In for Pricing
View Details
Vaccum Pump BVAP-303
BVAP-303 1 Unit

Vaccum Pump BVAP-303

Sign In for Pricing
View Details
Human ZFR activation kit by CRISPRa
GA109931 1 Kit

Human ZFR activation kit by CRISPRa

Sign In for Pricing
View Details