Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C3A/NT5C3, Human

NT5C3A/NT5C3 Protein, a nucleotidase, preferentially hydrolyzes cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m (7) GMP), emphasizing a potential role in cellular processes, with a preference for CMP. NT5C3A/NT5C3 Protein, Human is the recombinant human-derived NT5C3A/NT5C3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NT5C3A/NT5C3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nt5c3a-nt5c3-protein-human.html

Purity

99.00

Smiles

MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Molecular Formula

51251 (Gene_ID) Q9H0P0-1 (M12-L297) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferric oxide
abx186447-01 25 g

Ferric oxide

Sign In for Pricing
View Details
Ferric oxide
abx186447-02 100 g

Ferric oxide

Sign In for Pricing
View Details
Ferric oxide
abx186447-03 500 g

Ferric oxide

Sign In for Pricing
View Details
Tissue Factor Rabbit Polyclonal Antibody (FITC)
orb360815 100 µg

Tissue Factor Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
One step Polymer HRP Mouse, Rabbit & Rat (H+L) Detection Kit
IH-8067-110 110 mL

One step Polymer HRP Mouse, Rabbit & Rat (H+L) Detection Kit

Sign In for Pricing
View Details
IGSF10 Rabbit Polyclonal Antibody (BF555)
orb2378446 100 µL

IGSF10 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details