Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD44 antigen (CD44) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

CD44

UniProt

P16070

Expression Region

224-603aa

Organism

Homo sapiens

Target Sequence

LMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLS

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Field of Research

Immunology

Assay Type

Developed Protein

Relevance

Receptor for hyaluronic acid (HA). Mediates cell-cell and cell-matrix interactions through its affinity for HA, and possibly also through its affinity for other ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). Adhesion with HA plays an important role in cell migration, tumor growth and progression. In cancer cells, may play an important role in invadopodia formation. Also involved in lymphocyte activation, recirculation and homing, and in hatopoiesis. Altered expression or dysfunction causes numerous pathogenic phenotypes. Great protein heterogeneity due to numerous alternative splicing and post-translational modification events.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antibacterial agent 123
T74977-01 25 mg

Antibacterial agent 123

Sign In for Pricing
View Details
Antibacterial agent 123
T74977-02 50 mg

Antibacterial agent 123

Sign In for Pricing
View Details
Antibacterial agent 123
T74977-03 100 mg

Antibacterial agent 123

Sign In for Pricing
View Details
Anti-B7H6 antibody (DM173), Rabbit mAb
MBS188940-01 0.01 mg

Anti-B7H6 antibody (DM173), Rabbit mAb

Sign In for Pricing
View Details
Anti-B7H6 antibody (DM173), Rabbit mAb
MBS188940-02 0.1 mg

Anti-B7H6 antibody (DM173), Rabbit mAb

Sign In for Pricing
View Details
Anti-B7H6 antibody (DM173), Rabbit mAb
MBS188940-03 0.5 mg

Anti-B7H6 antibody (DM173), Rabbit mAb

Sign In for Pricing
View Details