Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Frizzled-2 (FZD2), partial

Product Specifications

Product Name Alternative

Fz-2; hFz2; FzE2

Abbreviation

Recombinant Human FZD2 protein, partial

Gene Name

FZD2

UniProt

Q14332

Expression Region

24-190aa

Organism

Homo sapiens (Human)

Target Sequence

QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPP

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. ; (Microbial infection) Acts as a receptor for C.difficile toxin TcdB in the colonic epithelium. TcdB occupies the binding site for Wnt-adducted palmitoleate in frizzled receptors and TcdB-binding prevents Wnt-binding and downstream Wnt signaling.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details