Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-2, Human (His)

Cofilin-2 protein controls actin polymerization and depolymerization in a pH-sensitive manner. Cofilin-2 Protein, Human (His) is the recombinant human-derived Cofilin-2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-2-protein-human-his.html

Purity

98.0

Smiles

ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

Molecular Formula

1073 (Gene_ID) Q9Y281-1 (A2-L166) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MAP1LC3A (LC3, APG8, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein 1 l
MBS6121375-01 0.2 mL

MAP1LC3A (LC3, APG8, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein 1 l

Ask
View Details
MAP1LC3A (LC3, APG8, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein 1 l
MBS6121375-02 5x 0.2 mL

MAP1LC3A (LC3, APG8, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein 1 l

Ask
View Details
Recombinant Anti-Lamin A + Lamin C antibody (Mouse mAb)
GB152400-50 50 μL

Recombinant Anti-Lamin A + Lamin C antibody (Mouse mAb)

Ask
View Details
ZNF843 Antibody - N-terminal region
MBS3203075-01 0.1 mL

ZNF843 Antibody - N-terminal region

Ask
View Details
ZNF843 Antibody - N-terminal region
MBS3203075-02 5x 0.1 mL

ZNF843 Antibody - N-terminal region

Ask
View Details
APC-Cy7 Linked Monoclonal Antibody to Toll Like Receptor 4 (TLR4)
MBS2116552-01 0.1 mL

APC-Cy7 Linked Monoclonal Antibody to Toll Like Receptor 4 (TLR4)

Ask
View Details