Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptotagmin-like protein 1 (Sytl1), partial

Product Specifications

Product Name Alternative

Exophilin-7

Abbreviation

Recombinant Mouse Sytl1 protein, partial

Gene Name

Sytl1

UniProt

Q99N80

Expression Region

31-87aa

Organism

Mus musculus (Mouse)

Target Sequence

LLDLSFLTEEEQEAISDVLKRDAHLRQLEEGRVSKLRASLEDPWQLKILTGDWFQEA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds phosphatidylinositol 3,4,5-trisphosphate. May play a role in vesicle trafficking. Acts as a RAB27A effector protein and may play a role in cytotoxic granule exocytosis in lymphocytes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1RAPL1 (Interleukin-1 Receptor Accessory Protein-like 1, IL-1-RAPL-1, IL-1RAPL-1, IL1RAPL-1, Oligophrenin-4, Three Immunoglobulin Domain-containing IL-1 Receptor-related 2, TIGIRR-2, X-linked Interleukin-1 Receptor Accessory Protein-like 1, OPHN4) (MaxLight 750) discontinued
128438-ML750 100 µL

IL1RAPL1 (Interleukin-1 Receptor Accessory Protein-like 1, IL-1-RAPL-1, IL-1RAPL-1, IL1RAPL-1, Oligophrenin-4, Three Immunoglobulin Domain-containing IL-1 Receptor-related 2, TIGIRR-2, X-linked Interleukin-1 Receptor Accessory Protein-like 1, OPHN4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TMEM120A Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV694740 1.0 µg DNA

TMEM120A Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Sox13 Protein Lysate (Mouse) with C-HA Tag
45136034 100 µg

Sox13 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PP3 (4-Amino-1-phenylpyrazolo[3,4-d]pyrimidine; NSC 1401) discontinued
P5504-25 10 mg

PP3 (4-Amino-1-phenylpyrazolo[3,4-d]pyrimidine; NSC 1401) discontinued

Sign In for Pricing
View Details
Mouse G protein-coupled receptor kinase 4 (GRK4) ELISA Kit
abx526237 96 Tests

Mouse G protein-coupled receptor kinase 4 (GRK4) ELISA Kit

Sign In for Pricing
View Details
Fth1 Mouse shRNA Plasmid (Locus ID 14319)
TL500736 1 Kit

Fth1 Mouse shRNA Plasmid (Locus ID 14319)

Sign In for Pricing
View Details