Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CS6 fimbrial subunit B/cssB, E.coli (His-SUMO)

CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssB is also required for stabilization of CssA, maximal adhesion of E.coli to epithelial cells and CS6 assembly. CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived CS6 fimbrial subunit B/cssB protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cs6-fimbrial-subunit-b-cssb-protein-e-coli-his-sumo.html

Smiles

GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

Molecular Formula

/ (Gene_ID) P53510 (G22-N167) (Accession)

Molecular Weight

Approximately 31.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human XTP3TPA (DCTPP1) activation kit by CRISPRa
GA112351 1 Kit

Human XTP3TPA (DCTPP1) activation kit by CRISPRa

Sign In for Pricing
View Details
DEFB132 (NM_207469) Human Over-expression Lysate
LC404044 20 µg

DEFB132 (NM_207469) Human Over-expression Lysate

Sign In for Pricing
View Details
EAAC1 Antibody: FITC
SMC-406D-FITC 100 µg

EAAC1 Antibody: FITC

Sign In for Pricing
View Details
GFAP Polyclonal Antibody
E-AB-40573-01 25 µL

GFAP Polyclonal Antibody

Sign In for Pricing
View Details
GFAP Polyclonal Antibody
E-AB-40573-02 100 µL

GFAP Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Carboxypeptidase M/CPM Protein (His Tag)
PKSM041195-01 10 µg

Recombinant Mouse Carboxypeptidase M/CPM Protein (His Tag)

Sign In for Pricing
View Details