Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Mouse (His)

The FGF-17 Protein is crucial in regulating embryonic development, functioning as a signaling molecule for inducing and patterning the embryonic brain. It plays an essential role in normal brain development and interacts specifically with FGFR3 and FGFR4 receptors, pivotal in this developmental process. FGF-17 Protein, Mouse (His) is the recombinant mouse-derived FGF-17, expressed by E. coli, with C-6*His labeled tag. The total length of FGF-17 Protein, Mouse (His) is 194 a.a..

Product Specifications

Product Name Alternative

FGF-17 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-mouse-his.html

Purity

98.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

14171 (Gene_ID) P63075 (T23-T216) (Accession)

Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R4 Recombinant Protein Antigen
NBP2-38276PEP 0.1 mL

PIK3R4 Recombinant Protein Antigen

Sign In for Pricing
View Details
FAM108A1 Antibody - C-terminal region : FITC (ARP67573_P050-FITC)
ARP67573_P050-FITC 100 µL

FAM108A1 Antibody - C-terminal region : FITC (ARP67573_P050-FITC)

Sign In for Pricing
View Details
RALGAPA1 Rabbit Polyclonal Antibody
orb327096 100 µL

RALGAPA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (MaxLight 550)
MBS6391436-01 0.1 mL

PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (MaxLight 550)

Sign In for Pricing
View Details
PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (MaxLight 550)
MBS6391436-02 5x 0.1 mL

PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (MaxLight 550)

Sign In for Pricing
View Details
pLVX-EnCMV-3×FLAG-CD163L1-PGK-Puro Plasmid
PVT42136 2 µg

pLVX-EnCMV-3×FLAG-CD163L1-PGK-Puro Plasmid

Sign In for Pricing
View Details