Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Mouse (147a.a)

Tumour Necrosis Factor alpha (TNF alpha) is a potent pro-inflammatory cytokine[1]. TNF alpha binds to its receptors, mainly TNFR1 and TNFR2, and then transmits molecular signals for biological functions such as inflammation and cell death[2]. TNF alpha stimulates NF-κB pathway via TNFR2 promotes cancer growth, invasion, and metastasis. Anti-TNF-α MAb significantly suppresses the tumor development in colitis-associated cancer (CAC) mouse[3]. TNF alpha as a proneurogenic factor activates the SAPK/JNK Pathway and can facilitate neuronal replacement and brain repair in response to brain injury[4].TNF-alpha/TNFSF2 Protein, Mouse is a recombinant protein consisting of 147 amino acids (D89-L235) and is produced in E. coli.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Mouse (147a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-protein-mouse.html

Purity

96.00

Smiles

DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Formula

21926 (Gene_ID) P06804 (D89-L235) (Accession)

Molecular Weight

Approximately 17.0 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Horiuchi T, et al. Transmembrane TNF-alpha: structure, function and interaction with anti-TNF agents. Rheumatology (Oxford) . 2010 Jul;49 (7) :1215-28.|[2]El-Tahan RR, et al. TNF-α gene polymorphisms and expression. Springerplus. 2016 Sep 7;5 (1) :1508.|[3]Jang DI, et al. The Role of Tumor Necrosis Factor Alpha (TNF-α) in Autoimmune Disease and Current TNF-α Inhibitors in Therapeutics. Int J Mol Sci. 2021 Mar 8;22 (5) :2719.|[4]Berguetti T, et al. TNF-α Modulates P-Glycoprotein Expression and Contributes to Cellular Proliferation via Extracellular Vesicles. Cells. 2019 May 24;8 (5) :500.|[5]Onizawa M, et al. Signaling pathway via TNF-alpha/NF-kappaB in intestinal epithelial cells may be directly involved in colitis-associated carcinogenesis. Am J Physiol Gastrointest Liver Physiol. 2009 Apr;296 (4) :G850-9.|[6]Bernardino L, et al. Tumor necrosis factor-alpha modulates survival, proliferation, and neuronal differentiation in neonatal subventricular zone cell cultures. Stem Cells. 2008 Sep;26 (9) :2361-71.|[7]Matsuno H, et al. The role of TNF-alpha in the pathogenesis of inflammation and joint destruction in rheumatoid arthritis (RA) : a study using a human RA/SCID mouse chimera. Rheumatology (Oxford) . 2002 Mar;41 (3) :329-37.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL
BNC040183-500 1x 500 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (IM260), CF647 conjugate, 0.1mg/mL
BNC470260-500 1x 500 µL

IgM Immunoglobulin (IM260), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details