Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tubulin cofactor A, Human (Tag Free)

The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E) . Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Tubulin cofactor A Protein, Human (Tag Free), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tubulin-cofactor-a-protein-human-tag-free.html

Purity

95.0

Smiles

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

Molecular Formula

6902 (Gene_ID) O75347 (M1-A108) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC9B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48711111 3x 1.0 µg

TTC9B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
OR10J5 AAV siRNA Pooled Vector
34898161 1.0 µg

OR10J5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Terbinafine Impurity 18
RM-T021418-01 10 mg

Terbinafine Impurity 18

Sign In for Pricing
View Details
Terbinafine Impurity 18
RM-T021418-02 25 mg

Terbinafine Impurity 18

Sign In for Pricing
View Details
Terbinafine Impurity 18
RM-T021418-03 50 mg

Terbinafine Impurity 18

Sign In for Pricing
View Details
Terbinafine Impurity 18
RM-T021418-04 100 mg

Terbinafine Impurity 18

Sign In for Pricing
View Details