Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Uncharacterized protein

Product Specifications

Abbreviation

Recombinant Cricetulus griseus Uncharacterized protein

UniProt

G3HIE8

Expression Region

1-64aa

Organism

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Target Sequence

MAGAGGRRAQGRFLRDGGFVMNQLSLKLTLCPTPDLGNKAHHDFSSYRNRKTNELQDQGLPNLN

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP4FC Polyclonal Antibody
RA31785-01 50 µL

CP4FC Polyclonal Antibody

Sign In for Pricing
View Details
CP4FC Polyclonal Antibody
RA31785-02 100 µL

CP4FC Polyclonal Antibody

Sign In for Pricing
View Details
Ddx41 ORF Vector (Mouse) (pORF)
17842014 1.0 µg DNA

Ddx41 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PAOX Blocking Peptide
33R-4825 100 ug

PAOX Blocking Peptide

Sign In for Pricing
View Details
Presenilin 1 (PSEN1) (NM_000021) Human Recombinant Protein
TP316443 20 µg

Presenilin 1 (PSEN1) (NM_000021) Human Recombinant Protein

Sign In for Pricing
View Details
Human Family With Sequence Similarity 3, Member A (FAM3A) ELISA Kit
YP-W19900-01 48 Tests

Human Family With Sequence Similarity 3, Member A (FAM3A) ELISA Kit

Sign In for Pricing
View Details