Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gag-Pol polyprotein, HIV (560a.a, His)

The Gag-Pol polyprotein plays a central role in virion assembly, cooperating with Gag to bind to the plasma membrane, promote protein-protein interactions, recruit viral Env proteins, and package genomic RNA through direct interaction with the RNA packaging sequence (Psi) . Gag-Pol polyprotein, HIV (560a.a, His) is the recombinant Virus-derived Gag-Pol polyprotein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Gag-Pol polyprotein, HIV (560a.a, His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gag-pol-polyprotein-hiv-560a-a-his.html

Purity

97.00

Smiles

PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

Molecular Formula

155348 (Gene_ID) P04585-1 (P588-L1147) (Accession)

Molecular Weight

Approximately 66-68 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TMEM110 shRNA Plasmid
abx976875-01 150 µg

Mouse TMEM110 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TMEM110 shRNA Plasmid
abx976875-02 300 µg

Mouse TMEM110 shRNA Plasmid

Sign In for Pricing
View Details
HOXD11 Rabbit Polyclonal Antibody (Fluoro647)
orb3096051 100 µg

HOXD11 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
PABPC4L Rabbit Polyclonal Antibody
orb1880324-01 30 µL

PABPC4L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PABPC4L Rabbit Polyclonal Antibody
orb1880324-02 50 µL

PABPC4L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PABPC4L Rabbit Polyclonal Antibody
orb1880324-03 100 µL

PABPC4L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details