APBA3, Human (His)
APBA3 Protein, Human (rHuAPBA3, His; Amyloid beta A4 precursor protein-binding family A member 3; APBA3) is an approximately 20.0 kDa APBA3 protein fused to His-tag. APBA3 Protein, Human (His) is an adapter protein that belongs to the X11 family and is involved in signal transduction processes[1].
Product Specifications
Product Name Alternative
APBA3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/apba3-protein-human-his.html
Smiles
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRLHHHHHH
Molecular Formula
9546 (Gene_ID) O96018 (M1-L138) (Accession)
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Aldolase, NT (Fructose-bisphosphate Aldolase A, Muscle-type Aldolase, Lung Cancer Antigen NY-LU-1, ALDOA, ALDA)
Aldolase, NT (Fructose-bisphosphate Aldolase A, Muscle-type Aldolase, Lung Cancer Antigen NY-LU-1, ALDOA, ALDA)
4- (3-Fluoro-4-methoxy-phenyl) -thiazol-2-ylamine Hydrobromide
4- (3-Fluoro-4-methoxy-phenyl) -thiazol-2-ylamine Hydrobromide