Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phoneutria nigriventer Omega-ctenitoxin-Pn3a

Product Specifications

Product Name Alternative

(Omega-CNTX-Pn3a) (Neurotoxin Tx3-4) (Omega-phonetoxin-2A) (Omega-phonetoxin-IIA) (Omega-Ptx-IIA) (PF3) (Phoneutriatoxin 3-4) (Pn3-4A)

Abbreviation

Recombinant Phoneutria nigriventer Omega-ctenitoxin-Pn3a protein

UniProt

P81790

Expression Region

40-115aa

Organism

Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)

Target Sequence

SCINVGDFCDGKKDDCQCCRDNAFCSCSVIFGYKTNCRCEVGTTATSYGICMAKHKCGRQTTCTKPCLSKRCKKNH

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

This toxin is a potent and practically irreversible antagonist of both Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channels, while it displays a partial and rapidly reversible block of Cav2.3/CACNA1E calcium channels and no effect on Cav3/CACNA1 calcium channels. Inhibits glutamate uptake from rat brain synaptosomes by an interaction between cysteines from both glutamate transporter and toxin. Blocks potassium-induced exocytosis of synaptic vesicles in brain cortical synaptosomes with an IC (50) of 1.1 nM. In mice, induces rapid general flaccid paralysis followed by death in 10-30 minutes at dose levels of 5 ug per mouse. In rat brain, inhibits glutamate release, neuronal death and loss of neurotransmission in the hippocampus resulting from ischemia.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.8 kDa

References & Citations

"Phoneutria spider toxins block ischemia-induced glutamate release, neuronal death, and loss of neurotransmission in hippocampus." Pinheiro A.C., da Silva A.J., Prado M.A., Cordeiro M.D., Richardson M., Batista M.C., de Castro Junior C.J., Massensini A.R., Guatimosim C., Romano-Silva M.A., Kushmerick C., Gomez M.V. Hippocampus 19:1123-1129 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog