Recombinant Phoneutria nigriventer Omega-ctenitoxin-Pn3a
Product Specifications
Product Name Alternative
(Omega-CNTX-Pn3a) (Neurotoxin Tx3-4) (Omega-phonetoxin-2A) (Omega-phonetoxin-IIA) (Omega-Ptx-IIA) (PF3) (Phoneutriatoxin 3-4) (Pn3-4A)
Abbreviation
Recombinant Phoneutria nigriventer Omega-ctenitoxin-Pn3a protein
UniProt
P81790
Expression Region
40-115aa
Organism
Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)
Target Sequence
SCINVGDFCDGKKDDCQCCRDNAFCSCSVIFGYKTNCRCEVGTTATSYGICMAKHKCGRQTTCTKPCLSKRCKKNH
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Others
Relevance
This toxin is a potent and practically irreversible antagonist of both Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channels, while it displays a partial and rapidly reversible block of Cav2.3/CACNA1E calcium channels and no effect on Cav3/CACNA1 calcium channels. Inhibits glutamate uptake from rat brain synaptosomes by an interaction between cysteines from both glutamate transporter and toxin. Blocks potassium-induced exocytosis of synaptic vesicles in brain cortical synaptosomes with an IC (50) of 1.1 nM. In mice, induces rapid general flaccid paralysis followed by death in 10-30 minutes at dose levels of 5 ug per mouse. In rat brain, inhibits glutamate release, neuronal death and loss of neurotransmission in the hippocampus resulting from ischemia.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
15.8 kDa
References & Citations
"Phoneutria spider toxins block ischemia-induced glutamate release, neuronal death, and loss of neurotransmission in hippocampus." Pinheiro A.C., da Silva A.J., Prado M.A., Cordeiro M.D., Richardson M., Batista M.C., de Castro Junior C.J., Massensini A.R., Guatimosim C., Romano-Silva M.A., Kushmerick C., Gomez M.V. Hippocampus 19:1123-1129 (2009)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items