Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OV16, Onchocerca volvulus (HEK293, GST)

The OV16 protein is a phosphatidylethanolamine-binding protein found in the subcutaneous tissue, stratum corneum, and uterus and has been shown to be involved in multiple physiological functions, possibly related to structural integrity and reproduction. It belongs to the phosphatidylethanolamine-binding protein family, suggesting a role in lipid processes or signaling. OV16 Protein, Onchocerca volvulus (HEK293, GST) is the recombinant OV16 protein, expressed by HEK293 , with N-GST labeled tag.

Product Specifications

Product Name Alternative

OV16 Protein, Onchocerca volvulus (HEK293, GST), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ov16-protein-onchocerca-volvulus-gst.html

Purity

97.27

Smiles

KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED

Molecular Formula

/ (Gene_ID) P31729 (K17-D197) (Accession)

Molecular Weight

Approximately 45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGSF8 Antibody
MBS9629957-01 0.1 mL

IGSF8 Antibody

Sign In for Pricing
View Details
IGSF8 Antibody
MBS9629957-02 0.2 mL

IGSF8 Antibody

Sign In for Pricing
View Details
IGSF8 Antibody
MBS9629957-03 5x 0.2 mL

IGSF8 Antibody

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody
abx275107-01 50 Tests

Annexin A2 (ANXA2) Antibody

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody
abx275107-02 100 Tests

Annexin A2 (ANXA2) Antibody

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody
abx275107-03 200 Tests

Annexin A2 (ANXA2) Antibody

Sign In for Pricing
View Details