Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Human (HEK293, His)

TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc protein, Human (HEK293, His) is the recombinant human-derived Tenascin/Tnc protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-human-hek293-his.html

Purity

98.00

Smiles

GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCS

Molecular Formula

3371 (Gene_ID) P24821-1 (G23-S621) (Accession)

Molecular Weight

Approximately 53-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (B-N36) [mFluor Violet 450 SE]
NBP3-14599MFV450 0.1 mL

Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (B-N36) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
LY6E Biosimilar Antibody
orb2321759-01 50 µg

LY6E Biosimilar Antibody

Sign In for Pricing
View Details
LY6E Biosimilar Antibody
orb2321759-02 100 µg

LY6E Biosimilar Antibody

Sign In for Pricing
View Details
CA9 antibody
10R-11187 100 ug

CA9 antibody

Sign In for Pricing
View Details
Quetmolimab (Biosimilar Reference Antibody) (CX3CL1)
RA0178-01 100 µg

Quetmolimab (Biosimilar Reference Antibody) (CX3CL1)

Sign In for Pricing
View Details
Quetmolimab (Biosimilar Reference Antibody) (CX3CL1)
RA0178-02 1 mg

Quetmolimab (Biosimilar Reference Antibody) (CX3CL1)

Sign In for Pricing
View Details