Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Creatine kinase M-type (Ckm)

Product Specifications

Product Name Alternative

(Creatine kinase M chain) (Creatine phosphokinase M-type) (CPK-M) (M-CK)

Abbreviation

Recombinant Mouse Ckm protein

Gene Name

Ckm

UniProt

P07310

Expression Region

1-381aa

Organism

Mus musculus (Mouse)

Target Sequence

MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) . Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.0 kDa

References & Citations

"Activation time of myocardial oxidative phosphorylation in creatine kinase and adenylate kinase knockout mice." Gustafson L.A., Van Beek J.H. Am J Physiol Heart Circ Physiol 282:H2259-64 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Chlorosulfonyl)benzoic Acid
TRC-C383100-2.5G 2.5 g

(Chlorosulfonyl)benzoic Acid

Sign In for Pricing
View Details
Phenol Red (>90%)
TRC-P295310-25G 25 g

Phenol Red (>90%)

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody [Clone ID: EDU-2]
AM26053BT-N 100 µg

CD4 Mouse Monoclonal Antibody [Clone ID: EDU-2]

Sign In for Pricing
View Details
Cytochrome C Rabbit Polyclonal Antibody
R1510-41 100 µL

Cytochrome C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HGF / SF (EGH2 4C12.1), CF640R conjugate, 0.1mg/mL
BNC402841-500 1x 500 µL

HGF / SF (EGH2 4C12.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tau Antibody
KC-11588-01 50 μL

Tau Antibody

Sign In for Pricing
View Details