Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his.html

Purity

95.00

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABAT (NM_000663) Human Over-expression Lysate
LY400218 100 µg

ABAT (NM_000663) Human Over-expression Lysate

Sign In for Pricing
View Details
Butachlor (>90%)
TRC-B689925-1G 1 g

Butachlor (>90%)

Sign In for Pricing
View Details
Calponin (CNN1) (NM_001299) Human Over-expression Lysate
LY400519 100 µg

Calponin (CNN1) (NM_001299) Human Over-expression Lysate

Sign In for Pricing
View Details
Calcein AM, 1 mg/mL in Anhydrous DMSO
#80011-2 1x 1 mL

Calcein AM, 1 mg/mL in Anhydrous DMSO

Sign In for Pricing
View Details
Tnfsf13b Rabbit Polyclonal Antibody
TA363046 100 µL

Tnfsf13b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rhof (NM_175092) Mouse Tagged ORF Clone
MG202289 10 µg

Rhof (NM_175092) Mouse Tagged ORF Clone

Sign In for Pricing
View Details