Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his.html

Purity

95.00

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentanedioic-d6 Acid
TRC-G598001-10MG 10 mg

Pentanedioic-d6 Acid

Sign In for Pricing
View Details
Caspase-6 Recombinant Rabbit Monoclonal Antibody [SC56-09]
ET1610-24 100 µL

Caspase-6 Recombinant Rabbit Monoclonal Antibody [SC56-09]

Sign In for Pricing
View Details
2-Amino-3,5-dibromobenzoic Acid
TRC-A610705-5G 5 g

2-Amino-3,5-dibromobenzoic Acid

Sign In for Pricing
View Details
p73 (TP73) (NM_005427) Human Recombinant Protein
TP320864L 1 mg

p73 (TP73) (NM_005427) Human Recombinant Protein

Sign In for Pricing
View Details
Ttf2 Mouse Gene Knockout Kit (CRISPR)
KN518433 1 Kit

Ttf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Activin B protein (His Tag)
PKSH034166-01 20 µg

Recombinant Human Activin B protein (His Tag)

Sign In for Pricing
View Details