Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his.html

Purity

95.00

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TKFC Antibody, Biotin conjugated
A56342-50UG 50 µg

TKFC Antibody, Biotin conjugated

Sign In for Pricing
View Details
Porcine Myosin 7 (MYH7) ELISA Kit
GTR10340738 96 Well

Porcine Myosin 7 (MYH7) ELISA Kit

Sign In for Pricing
View Details
CMPK (m) -PR
sc-105219-PR 10 µM - 20 µL

CMPK (m) -PR

Sign In for Pricing
View Details
Indolethylamine N-methyltransferase Rabbit Monoclonal Antibody [KD Validation]
E51K1195 40 µL

Indolethylamine N-methyltransferase Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
PON1 Rabbit mAb
AB101014 100 µL

PON1 Rabbit mAb

Sign In for Pricing
View Details
CXCL16 Blocking peptide
orb1442422 500 µg

CXCL16 Blocking peptide

Sign In for Pricing
View Details