Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-nerve growth factor (Ngf), partial (Active)

Product Specifications

Product Name Alternative

Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB

Abbreviation

Recombinant Mouse Ngf protein, partial (Active)

Gene Name

Ngf

UniProt

P01139

Expression Region

130-239aa

Organism

Mus musculus (Mouse)

Target Sequence

MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

NGF is the first member discovered in the Neurotrophin family, which includes brain-derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3), and neurotrophin-4 (NT-4) . These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. Mouse beta -NGF is a homodimer of two 120 amino acid polypeptides. It shares approximately 90% homology at the amino acid level with human beta -NGF and 95.8% with rat beta -NGF. NGF signaling has been shown to play an important role in neuroprotection and repair. β-NGF acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. It is a potent neurotrophic factor that signals through its receptor β-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 68.52 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Molecular Weight

12.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BHLHE41 Polyclonal Antibody
E55A02894 100 µg

BHLHE41 Polyclonal Antibody

Sign In for Pricing
View Details
Gab1 Antibody
OAAF05758-100UG 100 µg

Gab1 Antibody

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Protease HtpX (htpX)
orb2915903-01 20 µg

Recombinant Pseudomonas putida Protease HtpX (htpX)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Protease HtpX (htpX)
orb2915903-02 100 µg

Recombinant Pseudomonas putida Protease HtpX (htpX)

Sign In for Pricing
View Details
Olr463 Protein Vector (Rat) (pPB-C-His)
PV290126 500 ng

Olr463 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Nme7 ORF Vector (Mouse) (pORF)
31950015 1.0 µg DNA

Nme7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details