Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-6, Human

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. IL-6 Protein, Human (N-His) is the recombinant human-derived IL-6 protein, expressed by E. coli.

Product Specifications

Product Name Alternative

IL-6 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6-protein-human.html

Purity

98.0

Smiles

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Formula

3569 (Gene_ID) P05231 (V30-M212) (Accession)

Molecular Weight

Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nieken J, et al. Recombinant human interleukin-6 induces a rapid and reversible anemia in cancer patients. Blood. 1995 Aug 1;86 (3) :900-5.|[2]Castell JV, et al. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes. FEBS Lett. 1988 May 23;232 (2) :347-50.|[3]Gao X, et al., PIM1 is responsible for IL-6-induced breast cancer cell EMT and stemness via c-myc activation. Breast Cancer. 2019 Sep;26 (5) :663-671|[4]Asano S, et al. In vivo effects of recombinant human interleukin-6 in primates: stimulated production of platelets[J]. Blood, 1990, 75 (8) : 1602-1605.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Genorise® Ferret IL-12 Polyclonal Antibody
GR210012 100 µg

Genorise® Ferret IL-12 Polyclonal Antibody

Ask
View Details
Recombinant Mouse EphB4 / HTK Protein (Fc tag) (Fc tag)
MBS2546901-01 0.2 mg

Recombinant Mouse EphB4 / HTK Protein (Fc tag) (Fc tag)

Ask
View Details
Recombinant Mouse EphB4 / HTK Protein (Fc tag) (Fc tag)
MBS2546901-02 5x 0.2 mg

Recombinant Mouse EphB4 / HTK Protein (Fc tag) (Fc tag)

Ask
View Details
Human NID2 Recombinant Protein
PPT-14202 100 µg

Human NID2 Recombinant Protein

Ask
View Details
4- (N-Boc-N-methyl-aminomethyl) phenylboronic acid
429645-01 100 mg

4- (N-Boc-N-methyl-aminomethyl) phenylboronic acid

Ask
View Details
4- (N-Boc-N-methyl-aminomethyl) phenylboronic acid
429645-02 250 mg

4- (N-Boc-N-methyl-aminomethyl) phenylboronic acid

Ask
View Details