Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bothrops asper Snake venom metalloproteinase BaP1

Product Specifications

Product Name Alternative

(SVMP) (Hemorrhagic metalloproteinase BaP1) (Bap-1)

Abbreviation

Recombinant Bothrops asper Snake venom metalloproteinase BaP1 protein

UniProt

P83512

Expression Region

192-394aa

Organism

Bothrops asper (Terciopelo)

Target Sequence

QQRFSPRYIELAVVADHGIFTKYNSNLNTIRTRVHEMLNTVNGFYRSVDVHAPLANLEVWSKQDLIKVQKDSSKTLKSFGEWRERDLLPRISHDHAQLLTAVVFDGNTIGRAYTGGMCDPRHSVGVVRDHSKNNLWVAVTMAHELGHNLGIHHDTGSCSCGAKSCIMASVLSKVLSYEFSDCSQNQYETYLTNHNPQCILNKP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Zinc metalloprotease that exhibits a weak hemorrhagic activity (with a minimum hemorrhagic dose of 20 ug by intradermal and intramuscular injection into mice) . The basal membrane components collagen (all chains of type IV) (COL4A4), laminin and nidogen are all degraded by this toxin. Rapidly degrades the Aalpha-chain (FGA) of fibrinogen, and later on, degrades the Bbeta-chain (FGB) of fibrinogen. Also activates the complement system, and induces rat neutrophil chemotaxis. Induces edema in mouse food pad and shows a mild myotoxicity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.3 kDa

References & Citations

"Proteomic analysis of Bothrops pirajai snake venom and characterization of BpirMP, a new P-I metalloproteinase." Bernardes C.P., Menaldo D.L., Camacho E., Rosa J.C., Escalante T., Rucavado A., Lomonte B., Gutierrez J.M., Sampaio S.V. J. Proteomics 80:250-267 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Wnt3 ORF Vector (Mouse) (pORF)
50450014 1.0 µg DNA

Wnt3 ORF Vector (Mouse) (pORF)

Ask
View Details
HERPUD1 (HERP, KIAA0025, MIF1, Homocysteine-responsive Endoplasmic Reticulum-resident Ubiquitin-like Domain Member 1 Protein, Methyl Methanesulfonate (MMF) -inducible Fragment Protein 1) (MaxLight 405) discontinued
207695-ML405 100 µL

HERPUD1 (HERP, KIAA0025, MIF1, Homocysteine-responsive Endoplasmic Reticulum-resident Ubiquitin-like Domain Member 1 Protein, Methyl Methanesulfonate (MMF) -inducible Fragment Protein 1) (MaxLight 405) discontinued

Ask
View Details
ATOX1 Protein, Human, Recombinant (His Tag)
MBS8121908-01 0.1 mg

ATOX1 Protein, Human, Recombinant (His Tag)

Ask
View Details
ATOX1 Protein, Human, Recombinant (His Tag)
MBS8121908-02 5x 0.1 mg

ATOX1 Protein, Human, Recombinant (His Tag)

Ask
View Details
Rab 9A (6D717) : m-IgG Fc BP-HRP Bundle
sc-539431 1 Kit

Rab 9A (6D717) : m-IgG Fc BP-HRP Bundle

Ask
View Details