Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF2, Chicken (His)

FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (His) is the recombinant FGF2 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF2 Protein, Chicken (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf2-protein-chicken-his.html

Purity

92.0

Smiles

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Molecular Formula

396413 (Gene_ID) P48800 (P13-S158) (Accession)

Molecular Weight

27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chrysene
TRC-C428000-5G 5 g

Chrysene

Sign In for Pricing
View Details
Human CSGALNACT1 activation kit by CRISPRa
GA110972 1 Kit

Human CSGALNACT1 activation kit by CRISPRa

Sign In for Pricing
View Details
H-Val-Ser-OH
TRC-V991708-100MG 100 mg

H-Val-Ser-OH

Sign In for Pricing
View Details
Ropn1l Mouse Gene Knockout Kit (CRISPR)
KN514983 1 Kit

Ropn1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-HER2 / ErbB2 (Y1248) Recombinant Rabbit monoclonal Antibody
HA750926 100 µL

Phospho-HER2 / ErbB2 (Y1248) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS800700 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details