Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF2, Chicken (His)

FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (His) is the recombinant FGF2 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF2 Protein, Chicken (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf2-protein-chicken-his.html

Purity

92.0

Smiles

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Molecular Formula

396413 (Gene_ID) P48800 (P13-S158) (Accession)

Molecular Weight

27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHL2 Polyclonal Antibody
E-AB-15037-01 20 µL

FHL2 Polyclonal Antibody

Sign In for Pricing
View Details
FHL2 Polyclonal Antibody
E-AB-15037-02 60 µL

FHL2 Polyclonal Antibody

Sign In for Pricing
View Details
FHL2 Polyclonal Antibody
E-AB-15037-03 120 µL

FHL2 Polyclonal Antibody

Sign In for Pricing
View Details
FHL2 Polyclonal Antibody
E-AB-15037-04 200 µL

FHL2 Polyclonal Antibody

Sign In for Pricing
View Details
STAT2 Rabbit Polyclonal Antibody
AP08100PU-N 100 µL

STAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dynamin 3 (DNM3) (NM_015569) Human Over-expression Lysate
LY402450 100 µg

Dynamin 3 (DNM3) (NM_015569) Human Over-expression Lysate

Sign In for Pricing
View Details