Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin beta E chain (INHBE)

Product Specifications

Product Name Alternative

(Activin beta-E chain)

Abbreviation

Recombinant Human INHBE protein

Gene Name

INHBE

UniProt

P58166

Expression Region

237-350aa

Organism

Homo sapiens (Human)

Target Sequence

TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.5 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NUP62 (62kD nucleoporin, DKFZp547L134, FLJ20822, FLJ43869, IBSN, MGC841, Nuclear Pore Glycoprotein p62, nucleoporin 62kDa, Nucleoporin Nup62, nucleoporin p62, nucleoporin p62KD, NUP62, NUP62 Protein, p62, SNDI, ) discontinued
224663-01 50 µL

NUP62 (62kD nucleoporin, DKFZp547L134, FLJ20822, FLJ43869, IBSN, MGC841, Nuclear Pore Glycoprotein p62, nucleoporin 62kDa, Nucleoporin Nup62, nucleoporin p62, nucleoporin p62KD, NUP62, NUP62 Protein, p62, SNDI, ) discontinued

Ask
View Details
NUP62 (62kD nucleoporin, DKFZp547L134, FLJ20822, FLJ43869, IBSN, MGC841, Nuclear Pore Glycoprotein p62, nucleoporin 62kDa, Nucleoporin Nup62, nucleoporin p62, nucleoporin p62KD, NUP62, NUP62 Protein, p62, SNDI, ) discontinued
224663-02 100 µL

NUP62 (62kD nucleoporin, DKFZp547L134, FLJ20822, FLJ43869, IBSN, MGC841, Nuclear Pore Glycoprotein p62, nucleoporin 62kDa, Nucleoporin Nup62, nucleoporin p62, nucleoporin p62KD, NUP62, NUP62 Protein, p62, SNDI, ) discontinued

Ask
View Details
Human CXCL10/IP-10/CRG-2 Alexa Fluor 750 MAb (33036R)
IC266RS-100UG 100 µg

Human CXCL10/IP-10/CRG-2 Alexa Fluor 750 MAb (33036R)

Ask
View Details
Rabbit anti Caspase 10 Polyclonal Antibody
MBS460030-01 0.1 mg

Rabbit anti Caspase 10 Polyclonal Antibody

Ask
View Details
Rabbit anti Caspase 10 Polyclonal Antibody
MBS460030-02 5x 0.1 mg

Rabbit anti Caspase 10 Polyclonal Antibody

Ask
View Details
T-Boc-Aminooxy-PEG7-amine
MF-0049354-01 100 mg

T-Boc-Aminooxy-PEG7-amine

Ask
View Details