Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-2/CCL8, Mouse (HEK293, His)

MCP-2/CCL8 Protein, Mouse (HEK293, His) is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse (HEK293, His) is a recombinant mouse MCP-2/CCL8 (E20-P97) protein expressed by HEK293 with a his tag[1][2].

Product Specifications

Product Name Alternative

MCP-2/CCL8 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-2-ccl8-protein-mouse-hek293-his.html

Purity

95.0

Smiles

EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQPHHHHHH

Molecular Formula

20307 (Gene_ID) Q9Z121 (E20-P97) (Accession)

Molecular Weight

Approximately 12 kDa

References & Citations

[1]Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100 (4) :619-629.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Yuan-Yuan Deng, et al. Immunomodulatory activity and partial characterisation of polysaccharides from Momordica charantia. Molecules. 2014 Aug 29;19 (9) :13432-47.|[4]Kiyokazu Hiwatashi, et al. Suppression of SOCS3 in macrophages prevents cancer metastasis by modifying macrophage phase and MCP2/CCL8 induction. Cancer Lett. 2011 Sep 28;308 (2) :172-80.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin anti-human CD14
E16FHB0142-100 100 Tests

Biotin anti-human CD14

Sign In for Pricing
View Details
AffiniPure F (ab') 2 Fragment Goat Anti-Rabbit IgG (H+L), BF488 conjugated
orb2328061 100 µL

AffiniPure F (ab') 2 Fragment Goat Anti-Rabbit IgG (H+L), BF488 conjugated

Sign In for Pricing
View Details
WNT10B Rabbit pAb (APR23305N)
APR23305N-01 50 µL

WNT10B Rabbit pAb (APR23305N)

Sign In for Pricing
View Details
WNT10B Rabbit pAb (APR23305N)
APR23305N-02 100 µL

WNT10B Rabbit pAb (APR23305N)

Sign In for Pricing
View Details
WNT10B Rabbit pAb (APR23305N)
APR23305N-03 200 µL

WNT10B Rabbit pAb (APR23305N)

Sign In for Pricing
View Details
SENP8 (Sentrin-specific Protease 8, Sentrin/SUMO-specific Protease SENP8, Deneddylase-1, DEN1, FKSG8, NEDD8-specific Protease 1, NEDP1, Protease, Cysteine 2, PRSC2) (MaxLight 550)
133120-ML550 100 µL

SENP8 (Sentrin-specific Protease 8, Sentrin/SUMO-specific Protease SENP8, Deneddylase-1, DEN1, FKSG8, NEDD8-specific Protease 1, NEDP1, Protease, Cysteine 2, PRSC2) (MaxLight 550)

Sign In for Pricing
View Details