Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF8 Rabbit Monoclonal Antibody
E49Y7125 100 µL

RNF8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
2,4-Dichlorobenzophenone
TRC-D432010-25G 25 g

2,4-Dichlorobenzophenone

Sign In for Pricing
View Details
ZNF583 (NM_152478) Human Over-expression Lysate
LS147949-100ug 100 µg

ZNF583 (NM_152478) Human Over-expression Lysate

Sign In for Pricing
View Details
Genorise® Biotinylated Porcine IL-2 Polyclonal Antibody
GR109051 50 mg

Genorise® Biotinylated Porcine IL-2 Polyclonal Antibody

Sign In for Pricing
View Details
ALKBH5, ID (ALKBH5, ABH5, OFOXD1, Probable alpha-ketoglutarate-dependent dioxygenase ABH5, Alkylated DNA repair protein alkB homolog 5) (APC) discontinued
031809-APC 200 µL

ALKBH5, ID (ALKBH5, ABH5, OFOXD1, Probable alpha-ketoglutarate-dependent dioxygenase ABH5, Alkylated DNA repair protein alkB homolog 5) (APC) discontinued

Sign In for Pricing
View Details
VPS13B (NM_015243) Human Tagged ORF Clone Lentiviral Particle
RC215468L4V 200 µL

VPS13B (NM_015243) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details