Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lmna (NM_001002016) Rat Tagged ORF Clone Lentiviral Particle
RR204013L4V 200 µL

Lmna (NM_001002016) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Retinoic Acid Receptor beta   monoclonal antibody
MB11530 50ul

Retinoic Acid Receptor beta monoclonal antibody

Sign In for Pricing
View Details
FYTTD1 Antibody, FITC conjugated
A63835-50UG 50 µg

FYTTD1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Plscr3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6255307 1.0 µg DNA

Plscr3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PECI Protein Vector (Human) (pPM-C-His)
PV030736 500 ng

PECI Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GENLISA™ Human Fermitin family Homolog 3 (FERMT3) ELISA
KBH5281 1x 96 Well

GENLISA™ Human Fermitin family Homolog 3 (FERMT3) ELISA

Sign In for Pricing
View Details