Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dyrk1a shRNA (UAS) - Lentiviral mouse Dyrk1a shRNA (UAS, RFP) plasmid
GTR15116761 1 Vial

Lentiviral mouse Dyrk1a shRNA (UAS) - Lentiviral mouse Dyrk1a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
[KO Validated] HIBADH Rabbit pAb
A19871 1000 μL

[KO Validated] HIBADH Rabbit pAb

Sign In for Pricing
View Details
Trimethylbromosilane 98+%
242494-01 25 g

Trimethylbromosilane 98+%

Sign In for Pricing
View Details
Trimethylbromosilane 98+%
242494-02 100 g

Trimethylbromosilane 98+%

Sign In for Pricing
View Details
UBE2B (Ubiquitin-conjugating Enzyme E2B (RAD6 Homolog), E2-17kD, HHR6B, HR6B, RAD6B, UBC2) (MaxLight 650)
253200-ML650 100 µL

UBE2B (Ubiquitin-conjugating Enzyme E2B (RAD6 Homolog), E2-17kD, HHR6B, HR6B, RAD6B, UBC2) (MaxLight 650)

Sign In for Pricing
View Details
JAM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV664724 1.0 µg DNA

JAM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details