Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aggrecan (AGC1, CSPG1, MSK16, ACAN) (FITC)
MBS6249414-01 0.1 mL

Aggrecan (AGC1, CSPG1, MSK16, ACAN) (FITC)

Sign In for Pricing
View Details
Aggrecan (AGC1, CSPG1, MSK16, ACAN) (FITC)
MBS6249414-02 5x 0.1 mL

Aggrecan (AGC1, CSPG1, MSK16, ACAN) (FITC)

Sign In for Pricing
View Details
Food and Plant DNA Auto Tube
301634 96 Tests

Food and Plant DNA Auto Tube

Sign In for Pricing
View Details
MAP2K4
030416 100 µL

MAP2K4

Sign In for Pricing
View Details
NUP50, ID (NUP50, NPAP60L, Nuclear pore complex protein Nup50, 50kD nucleoporin, Nuclear pore-associated protein 60kD-like, Nucleoporin Nup50) (MaxLight 490)
MBS6327299-01 0.1 mL

NUP50, ID (NUP50, NPAP60L, Nuclear pore complex protein Nup50, 50kD nucleoporin, Nuclear pore-associated protein 60kD-like, Nucleoporin Nup50) (MaxLight 490)

Sign In for Pricing
View Details
NUP50, ID (NUP50, NPAP60L, Nuclear pore complex protein Nup50, 50kD nucleoporin, Nuclear pore-associated protein 60kD-like, Nucleoporin Nup50) (MaxLight 490)
MBS6327299-02 5x 0.1 mL

NUP50, ID (NUP50, NPAP60L, Nuclear pore complex protein Nup50, 50kD nucleoporin, Nuclear pore-associated protein 60kD-like, Nucleoporin Nup50) (MaxLight 490)

Sign In for Pricing
View Details