Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SMYD2 shRNA (UAS) - Lentiviral human SMYD2 shRNA (UAS, iRFP) (100)
GTR15127635 1 Vial

Lentiviral human SMYD2 shRNA (UAS) - Lentiviral human SMYD2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SCMH1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43170062 1.0 µg DNA

SCMH1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse TMX4 shRNA Plasmid
abx974291-01 150 µg

Mouse TMX4 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TMX4 shRNA Plasmid
abx974291-02 300 µg

Mouse TMX4 shRNA Plasmid

Sign In for Pricing
View Details
HDDC3 Antibody / HD domain-containing protein 3
FY13167 100 µg

HDDC3 Antibody / HD domain-containing protein 3

Sign In for Pricing
View Details
Activating Transcription Factor 2, phosphorylated (Thr71) (ATF2, cAMP Response Element Binding Protein 2, CRE BP1, CREB 2, CREB2, CREBP1, HB 16, HB16, MGC111558, mXBP, TREB 7, TREB7)
A0855-43H 100 µg

Activating Transcription Factor 2, phosphorylated (Thr71) (ATF2, cAMP Response Element Binding Protein 2, CRE BP1, CREB 2, CREB2, CREBP1, HB 16, HB16, MGC111558, mXBP, TREB 7, TREB7)

Sign In for Pricing
View Details