Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SDR16C5 Antibody
NBP1-87150-25ul 25 µL

Rabbit Polyclonal SDR16C5 Antibody

Sign In for Pricing
View Details
Mouse B-lymphocyte antigen CD20, Ms4a1 ELISA KIT
ELI-33997m 96 Tests

Mouse B-lymphocyte antigen CD20, Ms4a1 ELISA KIT

Sign In for Pricing
View Details
TAF5L Rabbit Polyclonal Antibody
TA330609 100 µL

TAF5L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GAPDHP44 3'UTR GFP Stable Cell Line
TU058599 1.0 mL

GAPDHP44 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal RBP4/Retinol-Binding Protein 4 Antibody (RB42) [Janelia Fluor 585]
NBP1-05426JF585 0.2 mL

Mouse Monoclonal RBP4/Retinol-Binding Protein 4 Antibody (RB42) [Janelia Fluor 585]

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) ROGDI Polyclonal Antibody
MBS9014814 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) ROGDI Polyclonal Antibody

Sign In for Pricing
View Details