Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf4 (NM_019182) Rat Untagged Clone
RN204755 10 µg

Rnf4 (NM_019182) Rat Untagged Clone

Sign In for Pricing
View Details
Bovine Osteopontin (OPN) ELISA Kit
RD-OPN-b-01 96 Tests

Bovine Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details
Bovine Osteopontin (OPN) ELISA Kit
RD-OPN-b-02 48 Tests

Bovine Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details
LGTN sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1212305 3x 1.0 µg

LGTN sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rat Monoclonal IL-1 RII Antibody (RM0014-7D7) [FITC]
NB110-85472F 0.1 mL

Rat Monoclonal IL-1 RII Antibody (RM0014-7D7) [FITC]

Sign In for Pricing
View Details
Canine CD34 Alexa Fluor 750 Antibody (Clone 1H6)
FAB3346S-100UG 100 µg

Canine CD34 Alexa Fluor 750 Antibody (Clone 1H6)

Sign In for Pricing
View Details