Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTF6A 3'UTR GFP Stable Cell Line
TU066029 1.0 mL

NTF6A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PRELP Protein Vector (Mouse) (pPB-N-His)
PV219079 500 ng

PRELP Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human GCC1 knockdown cell line
ABC-KD5951 1 Vial

Human GCC1 knockdown cell line

Sign In for Pricing
View Details
ZFAND5 (NM_006007) Human Tagged ORF Clone
RC209943 10 µg

ZFAND5 (NM_006007) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human RPN1
P9157-01 50 µg

Recombinant Human RPN1

Sign In for Pricing
View Details
Recombinant Human RPN1
P9157-02 200 µg

Recombinant Human RPN1

Sign In for Pricing
View Details