Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBPMS2 (NM_194272) Human Over-expression Lysate
LY405113 100 µg

RBPMS2 (NM_194272) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Fblim1 shRNA (UAS) - Lentiviral mouse Fblim1 shRNA (UAS) plasmid
GTR15294826 1 Vial

Lentiviral mouse Fblim1 shRNA (UAS) - Lentiviral mouse Fblim1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Cyp2j10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7274107 1.0 µg DNA

Cyp2j10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rabbit Primary Hippocampal Neuron Cells
AFG-ELL-0902 > 5x 10^5 Cells / Vial

Rabbit Primary Hippocampal Neuron Cells

Sign In for Pricing
View Details
Phospho-Histone H3-T45 Rabbit pAb
E45R29669N-100 100 µL

Phospho-Histone H3-T45 Rabbit pAb

Sign In for Pricing
View Details
TGF alpha (TGFA) Mouse Monoclonal Antibody [Clone ID: TG86]
AM50310PU-S 100 µg

TGF alpha (TGFA) Mouse Monoclonal Antibody [Clone ID: TG86]

Sign In for Pricing
View Details