Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IAV H3N2 Hemagglutinin / HA1 Protein (aa 1-345) [His] (A/California/7/2004)
VAng-Wyb7036-100g 100 µg

Recombinant IAV H3N2 Hemagglutinin / HA1 Protein (aa 1-345) [His] (A/California/7/2004)

Sign In for Pricing
View Details
Mmu-miR-5098 agomir
HY-R03244A-01 5 nmol

Mmu-miR-5098 agomir

Sign In for Pricing
View Details
Mmu-miR-5098 agomir
HY-R03244A-02 20 nmol

Mmu-miR-5098 agomir

Sign In for Pricing
View Details
Rat Thymic Stromal Lymphopoietin CLIA Kit
MBS8427013-01 1 Kit

Rat Thymic Stromal Lymphopoietin CLIA Kit

Sign In for Pricing
View Details
Rat Thymic Stromal Lymphopoietin CLIA Kit
MBS8427013-02 5x 1 Kit

Rat Thymic Stromal Lymphopoietin CLIA Kit

Sign In for Pricing
View Details
4931431F19Rik 3'UTR GFP Stable Cell Line
TU150806 1.0 mL

4931431F19Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details