Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Npas4 shRNA (UAS) - Lentiviral mouse Npas4 shRNA (UAS, RFP) plasmid
GTR15247873 1 Vial

Lentiviral mouse Npas4 shRNA (UAS) - Lentiviral mouse Npas4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
AOC2 antibody (retina specific)
MBS839692-01 0.1 mL

AOC2 antibody (retina specific)

Sign In for Pricing
View Details
AOC2 antibody (retina specific)
MBS839692-02 5x 0.1 mL

AOC2 antibody (retina specific)

Sign In for Pricing
View Details
ACAA2 Recombinant Antibody, APC Conjugated
bsm-62464R-APC 100 µL

ACAA2 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
COX5BL2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0493602 1.0 µg DNA

COX5BL2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Pyruvate Kinase (PKLR) CytoSection
TS406455P5 25 Slides

Pyruvate Kinase (PKLR) CytoSection

Sign In for Pricing
View Details