DKK-1, Human (HEK293, His)
Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.
Product Specifications
Product Name Alternative
DKK-1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html
Purity
98.0
Smiles
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR
Molecular Formula
22943 (Gene_ID) O94907 (T32-R265) (Accession)
Molecular Weight
Approximately 35-51 kDa due to the glycosylation
References & Citations
[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC202683L3V 200 µL
SERPINB3 (NM_006919) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS6389443-01 0.1 mL
PIK3R5 (Phosphoinositide 3-kinase Regulatory Subunit 5, PI3-kinase p101 Subunit, Phosphatidylinositol 4,5-bisphosphate 3-kinase Regulatory Subunit, Protein FOAP-2, PtdIns-3-kinase p101, p101-PI3K) (MaxLight 405)
Sign In for Pricing
View Details 
MBS6389443-02 5x 0.1 mL
PIK3R5 (Phosphoinositide 3-kinase Regulatory Subunit 5, PI3-kinase p101 Subunit, Phosphatidylinositol 4,5-bisphosphate 3-kinase Regulatory Subunit, Protein FOAP-2, PtdIns-3-kinase p101, p101-PI3K) (MaxLight 405)
Sign In for Pricing
View Details MBS6130484-01 0.1 mL
CD96 (T-cell Surface Protein Tactile, Cell Surface Antigen CD96, T Cell-activated Increased Late Expression Protein) (AP)
Sign In for Pricing
View Details MBS6130484-02 5x 0.1 mL
CD96 (T-cell Surface Protein Tactile, Cell Surface Antigen CD96, T Cell-activated Increased Late Expression Protein) (AP)
Sign In for Pricing
View Details