Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryge 3'UTR Luciferase Stable Cell Line
TU104410 1.0 mL

Cryge 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GDF7 Polyclonal Antibody
E55A03381 100 µg

GDF7 Polyclonal Antibody

Sign In for Pricing
View Details
Stag2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6384708 1.0 µg DNA

Stag2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
NIBR-189
MBS130654-01 100 mg

NIBR-189

Sign In for Pricing
View Details
NIBR-189
MBS130654-02 500 mg

NIBR-189

Sign In for Pricing
View Details
Hexokinase 3 (HXK3, HK3, Hexokinase Type III, HK III)
H2035-36 100 µg

Hexokinase 3 (HXK3, HK3, Hexokinase Type III, HK III)

Sign In for Pricing
View Details