Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2V1 cDNA Clone
MBS1277948-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

UBE2V1 cDNA Clone

Sign In for Pricing
View Details
UBE2V1 cDNA Clone
MBS1277948-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

UBE2V1 cDNA Clone

Sign In for Pricing
View Details
Lentiviral mouse Sf1 shRNA (UAS) - Lentiviral mouse Sf1 shRNA (UAS, RFP) (25)
GTR15195203 1 Vial

Lentiviral mouse Sf1 shRNA (UAS) - Lentiviral mouse Sf1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Plant Thyroid Hormone Receptor Alpha (THRA) ELISA Kit
MBS9373399 Inquire

Plant Thyroid Hormone Receptor Alpha (THRA) ELISA Kit

Sign In for Pricing
View Details
FAM107A (DRR1, TU3A, Protein FAM107A, Down-regulated in Renal Cell Carcinoma 1, Protein TU3A, FLJ30158, FLJ45473) (APC)
137948-APC 100 µL

FAM107A (DRR1, TU3A, Protein FAM107A, Down-regulated in Renal Cell Carcinoma 1, Protein TU3A, FLJ30158, FLJ45473) (APC)

Sign In for Pricing
View Details
PPP1R11P1 ORF Vector (Human) (pORF)
ORF028175 1.0 µg DNA

PPP1R11P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details