Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAP2 (B-2) Alexa Fluor® 594
sc-515576 AF594 200 µg/mL

TAP2 (B-2) Alexa Fluor® 594

Sign In for Pricing
View Details
Goat Transforming Growth Factor Beta 1 (TGF-β1) ELISA Kit
NSL1243Gt 96 Tests

Goat Transforming Growth Factor Beta 1 (TGF-β1) ELISA Kit

Sign In for Pricing
View Details
Mannose Receptor C Type 1 (MRC1) Magnetic Fluorescence Assay Kit
MBS2157510-01 96 Tests

Mannose Receptor C Type 1 (MRC1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Mannose Receptor C Type 1 (MRC1) Magnetic Fluorescence Assay Kit
MBS2157510-02 5x 96 Tests

Mannose Receptor C Type 1 (MRC1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Mannose Receptor C Type 1 (MRC1) Magnetic Fluorescence Assay Kit
MBS2157510-03 10x 96 Tests

Mannose Receptor C Type 1 (MRC1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cadherin EGF LAG Seven Pass G-Type Receptor 3 (CELSR3)
MBS2078056-01 0.1 mL

FITC-Linked Polyclonal Antibody to Cadherin EGF LAG Seven Pass G-Type Receptor 3 (CELSR3)

Sign In for Pricing
View Details