Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium Caseinate extrapure, 90% Protein
47700-01 100 g

Calcium Caseinate extrapure, 90% Protein

Sign In for Pricing
View Details
Calcium Caseinate extrapure, 90% Protein
47700-02 500 g

Calcium Caseinate extrapure, 90% Protein

Sign In for Pricing
View Details
Influenza A Hemagglutinin (H1N1, A/California/14/2009) (PE)
MBS6481653-01 0.1 mL

Influenza A Hemagglutinin (H1N1, A/California/14/2009) (PE)

Sign In for Pricing
View Details
Influenza A Hemagglutinin (H1N1, A/California/14/2009) (PE)
MBS6481653-02 5x 0.1 mL

Influenza A Hemagglutinin (H1N1, A/California/14/2009) (PE)

Sign In for Pricing
View Details
TPA, ID (Tissue-type Plasminogen Activator, t-plasminogen Activator, t-PA, tPA, INN=Alteplase, INN=Reteplase, Tissue-type Plasminogen Activator Chain A, Tissue-type Plasminogen Activator Chain B, PLAT) (MaxLight 750) discontinued
T5600-10H-ML750 100 µL

TPA, ID (Tissue-type Plasminogen Activator, t-plasminogen Activator, t-PA, tPA, INN=Alteplase, INN=Reteplase, Tissue-type Plasminogen Activator Chain A, Tissue-type Plasminogen Activator Chain B, PLAT) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mars1 (NM_001003913) Mouse Tagged ORF Clone
MR211112 10 µg

Mars1 (NM_001003913) Mouse Tagged ORF Clone

Sign In for Pricing
View Details