Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek293.html

Purity

98.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

Molecular Formula

22943 (Gene_ID) O94907 (T32-R265) (Accession)

Molecular Weight

Approximately 35-51 kDa due to the glycosylation

References & Citations

[1]Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3) : 423–34.|[3]Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1) : 720–30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMPX (Small Muscle Protein, X-linked, DFN6, DFNX4) (MaxLight 750)
MBS6449471-01 0.1 mL

SMPX (Small Muscle Protein, X-linked, DFN6, DFNX4) (MaxLight 750)

Sign In for Pricing
View Details
SMPX (Small Muscle Protein, X-linked, DFN6, DFNX4) (MaxLight 750)
MBS6449471-02 5x 0.1 mL

SMPX (Small Muscle Protein, X-linked, DFN6, DFNX4) (MaxLight 750)

Sign In for Pricing
View Details
CDHR4 Rabbit Polyclonal Antibody
TA367967 100 µL

CDHR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIRT2 Recombinant Antibody, Biotin Conjugated
bsm-52221R-Biotin 100 µL

SIRT2 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS804857 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
RAB20, CT (RAB20, Ras-related protein Rab-20) (MaxLight 490) discontinued
040741-ML490 100 µL

RAB20, CT (RAB20, Ras-related protein Rab-20) (MaxLight 490) discontinued

Sign In for Pricing
View Details